UNC5H3/UNC5C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69283

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UNC5H3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C (NP_003719). Peptide sequence WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UNC5H3/UNC5C Antibody - BSA Free

Western Blot: UNC5H3/UNC5C Antibody [NBP1-69283]

Western Blot: UNC5H3/UNC5C Antibody [NBP1-69283]

Western Blot: UNC5H3/UNC5C Antibody [NBP1-69283] - This Anti-UNC5C antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Applications for UNC5H3/UNC5C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UNC5H3

UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Long Name

Netrin Receptor UNC5C

Alternate Names

UNC5C

Entrez Gene IDs

8633 (Human)

Gene Symbol

UNC5C

UniProt

O95185

Additional UNC5H3 Products

Product Documents for UNC5H3/UNC5C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UNC5H3/UNC5C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Apoptosis

Customer Reviews for UNC5H3/UNC5C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UNC5H3/UNC5C Antibody - BSA Free and earn rewards!

Have you used UNC5H3/UNC5C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies