UPF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57706

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UPF2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UPF2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UPF2 Antibody [NBP2-57706]

Immunocytochemistry/ Immunofluorescence: UPF2 Antibody [NBP2-57706]

Immunocytochemistry/Immunofluorescence: UPF2 Antibody [NBP2-57706] - Staining of human cell line HaCaT shows localization to cytosol & cytoplasmic bodies.

Applications for UPF2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UPF2

UPF2 encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p. Two splice variants have been found for this gene; both variants encode the same protein.

Alternate Names

DKFZp434D222, hUpf2, KIAA1408MGC138835, Nonsense mRNA reducing factor 2, regulator of nonsense transcripts 2, RENT2MGC138834, smg-3, UPF2 regulator of nonsense transcripts homolog (yeast), Up-frameshift suppressor 2 homolog, yeast Upf2p homolog

Gene Symbol

UPF2

Additional UPF2 Products

Product Documents for UPF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UPF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UPF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UPF2 Antibody - BSA Free and earn rewards!

Have you used UPF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies