WFDC3 Antibody (5C12) - Azide and BSA Free

Novus Biologicals | Catalog # H00140686-M03

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 5C12

Format

Azide and BSA Free
View all WFDC3 Primary Antibodies »

Product Specifications

Immunogen

WFDC3 (AAH26014.2, 1 a.a. ~ 48 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for WFDC3 Antibody (5C12) - Azide and BSA Free

Sandwich ELISA: WFDC3 Antibody (5C12) [H00140686-M03] - Detection limit for recombinant GST tagged WFDC3 is 0.1 ng/ml as a capture antibody.

Applications for WFDC3 Antibody (5C12) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: WFDC3

The WFDC3 gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The enco

Alternate Names

WAP four-disulfide core domain 3

Gene Symbol

WFDC3

UniProt

AAH26014 (Human)

Additional WFDC3 Products

Product Documents for WFDC3 Antibody (5C12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WFDC3 Antibody (5C12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WFDC3 Antibody (5C12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review WFDC3 Antibody (5C12) - Azide and BSA Free and earn rewards!

Have you used WFDC3 Antibody (5C12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies