ZMIZ1/Zimp10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88637

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZMIZ1/Zimp10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZMIZ1/Zimp10. Peptide sequence: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZMIZ1/Zimp10 Antibody - BSA Free

Western Blot: ZMIZ1/Zimp10 Antibody [NBP2-88637]

Western Blot: ZMIZ1/Zimp10 Antibody [NBP2-88637]

Western Blot: ZMIZ1/Zimp10 Antibody [NBP2-88637] - WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: 293T cell lysate
Western Blot: ZMIZ1/Zimp10 Antibody [NBP2-88637]

Western Blot: ZMIZ1/Zimp10 Antibody [NBP2-88637]

Western Blot: ZMIZ1/Zimp10 Antibody [NBP2-88637] - Lanes: Lane 1: 50ug mouse retina extract. Lane 2: 50ug mouse prostate extract. Lane 3: 50ug mouse testis extract. Lane 4: 50ug mouse colon extract. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-rabbit HRP. Secondary Antibody Dilution: 1:10

Applications for ZMIZ1/Zimp10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZMIZ1/Zimp10

Increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation

Long Name

Zinc Finger, MIZ-Type Containing 1

Alternate Names

KIAA1224, RAI17, TRAFIP10, Zimp10

Gene Symbol

ZMIZ1

Additional ZMIZ1/Zimp10 Products

Product Documents for ZMIZ1/Zimp10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZMIZ1/Zimp10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZMIZ1/Zimp10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZMIZ1/Zimp10 Antibody - BSA Free and earn rewards!

Have you used ZMIZ1/Zimp10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies