ZP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30830

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZP3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZP3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830]

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830]

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830]

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830]

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830]

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830]

Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830] - Staining of human ovary shows strong membranous and cytoplasmic positivity in oocyte.

Applications for ZP3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZP3

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. [provided by RefSeq]

Alternate Names

zona pellucida glycoprotein 3 (sperm receptor)

Gene Symbol

ZP3

UniProt

P21754 (Human)

Additional ZP3 Products

Product Documents for ZP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ZP3 Antibody - BSA Free

Customer Reviews for ZP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZP3 Antibody - BSA Free and earn rewards!

Have you used ZP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies