Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

Novus Biologicals | Catalog # H00007534-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection, SDS-PAGE
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-245 of Human YWHAZ

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

54.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

SDS-PAGE: Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein [H00007534-P01]

SDS-PAGE: Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein [H00007534-P01]

SDS-Page: Recombinant Human 14-3-3 zeta/delta Protein [H00007534-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00007534-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: 14-3-3 zeta/delta

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene. [provided by RefSeq]

Alternate Names

KCIP-1MGC126532,14-3-3-zeta, MGC111427, MGC138156, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide, zeta polypeptide

Gene Symbol

YWHAZ

Additional 14-3-3 zeta/delta Products

Product Documents for Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

Showing  1 - 11 FAQ Showing All
  • Q: Is the product 14-3-3 zeta/delta Recombinant Protein H00007534-P01 dry ice shipment?

    A: The recombinant protein you inquired about, H00007534-P01, does ship on dry ice and has a storage requirement of -80C.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...