alcohol dehydrogenase 7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90232

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alcohol dehydrogenase 7 Antibody - BSA Free

alcohol dehydrogenase 7 Antibody - BSA Free Immunohistochemistry: alcohol dehydrogenase 7 Antibody - BSA Free [NBP1-90232]

Immunohistochemistry: alcohol dehydrogenase 7 Antibody - BSA Free [NBP1-90232]

Analysis in human esophagus and pancreas tissues using NBP1-90232 antibody. Corresponding ADH7 RNA-seq data are presented for the same tissues.
alcohol dehydrogenase 7 Antibody - BSA Free Western Blot: alcohol dehydrogenase 7 Antibody - BSA Free [NBP1-90232]

Western Blot: alcohol dehydrogenase 7 Antibody - BSA Free [NBP1-90232]

Lane 1: Mouse liver tissue lysate
Lane 2: Rat liver tissue lysate
alcohol dehydrogenase 7 Antibody - BSA Free Western Blot: alcohol dehydrogenase 7 Antibody - BSA Free [NBP1-90232]

Western Blot: alcohol dehydrogenase 7 Antibody - BSA Free [NBP1-90232]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue

Applications for alcohol dehydrogenase 7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase 7

alcohol dehydrogenase 7 encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. [provided by RefSeq]

Alternate Names

ADH4, ADH-4, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide, alcohol dehydrogenase class 4 mu/sigma chain, Alcohol dehydrogenase class IV mu/sigma chain, alcohol dehydrogenase VII, alcohol dehydrogenase-7, class IV sigma-1 alcohol dehydrogenase, class IV sigmasigma alcohol dehydrogenase, EC 1.1.1, EC 1.1.1.1, Gastric alcohol dehydrogenase, Retinol dehydrogenase

Gene Symbol

ADH7

Additional alcohol dehydrogenase 7 Products

Product Documents for alcohol dehydrogenase 7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alcohol dehydrogenase 7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alcohol dehydrogenase 7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alcohol dehydrogenase 7 Antibody - BSA Free and earn rewards!

Have you used alcohol dehydrogenase 7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...