AMN is type I transmembrane protein that is required for surface expression of the extracellular membrane-associated protein, cubilin. The two form a complex termed CUBAM in which AMN mediates endocytosis of compounds bound by cubulin. AMN is required for embryonic primitive streak formation in the mouse, and is highly expressed on adult polarized epithelia in the small intestine and kidney proximal convoluted tubules. Mutations of AMN or cubilin cause Imersund-Grasbeck syndrome, also called megaloblastic anemia-1, characterized by malabsorption of cobalamin (vitamin B12).
Amnionless/AMN Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP1-91203PEP
Loading...
Key Product Details
Source
E. coli
Applications
Antibody Competition
Loading...
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMN.
Source: E. coli
Amino Acid Sequence: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91203.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation, and Storage
NBP1-91203PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Amnionless
Alternate Names
AMN
Gene Symbol
AMN
Additional Amnionless Products
Product Documents for Amnionless/AMN Recombinant Protein Antigen
Product Specific Notices for Amnionless/AMN Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Amnionless/AMN Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review Amnionless/AMN Recombinant Protein Antigen and earn rewards!
Have you used Amnionless/AMN Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Loading...