Apelin-36 (rat, mouse)

Catalog #: 2427 Datasheet / COA / SDS

Discontinued Product

2427 has been discontinued.
View all Apelin Receptor Agonists products.
Apelin-36 (rat, mouse)
1 Image
Description: Endogenous apelin agonist
Product Details
Reviews

Biological Activity

Apelin-36 (rat, mouse) is an endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:
4200.93
Formula:
C185H304N68O43S
Sequence:
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1.60 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
230299-95-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Apelin peptides block the entry of human immunodeficiency virus (HIV).
    Zou et al.
    FEBS Lett., 2000;473:15
  2. Molecular properties of apelin: tissue distribution and receptor binding.
    Kawamata et al.
    Biochim.Biophys.Acta, 2001;1538:162
  3. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.
    Tatemoto et al.
    Biochem.Biophys.Res.Comms., 1998;251:471

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Apelin-36 (rat, mouse)

There are currently no reviews for this product. Be the first to review Apelin-36 (rat, mouse) and earn rewards!

Have you used Apelin-36 (rat, mouse)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.