Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)

Novus Biologicals | Catalog # NBP3-16872

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0V1R8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 864-963 of human Apolipoprotein E R2/ApoE R2 (Q14114). PVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) [NBP3-16872]

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) [NBP3-16872]

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) [NBP3-16872] - Western blot analysis of extracts of various cell lines, using Apolipoprotein E R2/ApoE R2 Rabbit mAb (NBP3-16872) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein E R2/ApoE R2

Apolipoprotein E Receptor 2 (ApoER2), also known as LRP8, is a Low-density lipoprotein receptor family member involved in endocytosis and signal transduction. Specifically, ApoER-2 is responsible for the cellular recognition and internalization of ApoE containing lipoproteins, including VLDL and HDL.

ApoER2 is expressed mainly in the brain, placenta, platelets and megakaryocytic cells, but not in the liver. LRP8 mutations can cause myocardial infarction type 1 (MCI1), a condition characterized by the irreversible necrosis of heart muscle secondary to prolonged ischemia. ApoER2 may also play a role in debilitating neurodegenerative diseases such as schizophrenia and Alzheimer's disease.

ApoER2 antibodies are useful tools for studying certian cardiac and neurodegenerative diseases.

Long Name

Apolipoprotein E Receptor 2

Alternate Names

ApoER2, Lr8b, LRP-8, LRP8

Gene Symbol

LRP8

Additional Apolipoprotein E R2/ApoE R2 Products

Product Documents for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)

There are currently no reviews for this product. Be the first to review Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) and earn rewards!

Have you used Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...