Axotrophin Antibody (4G3) - Azide and BSA Free

Novus Biologicals | Catalog # H00064844-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4G3

Format

Azide and BSA Free
View all Axotrophin Primary Antibodies »

Product Specifications

Immunogen

MARCH7 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG

Specificity

This product is specific for Human MARCH7 monoclonal antibody (M02), clone 4G3 [Gene ID: 64844].

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for Axotrophin Antibody (4G3) - Azide and BSA Free

Sandwich ELISA: Axotrophin Antibody (4G3) [H00064844-M02] - Detection limit for recombinant GST tagged MARCH7 is 0.3 ng/ml as a capture antibody.

Applications for Axotrophin Antibody (4G3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Mouse monoclonal antibody raised against a partial recombinant MARCH7.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Axotrophin

E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligasesaccept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer theubiquitin to targeted substrates

Alternate Names

AXO, AXOT, Axotrophin, E3 ubiquitin-protein ligase MARCH7, EC 6.3.2, EC 6.3.2.-, MARCH-VIIDKFZp586F1122, membrane-associated ring finger (C3HC4) 7, Membrane-associated RING finger protein 7, Membrane-associated RING-CH protein VII, RING finger protein 177, RNF177axotrophin

Gene Symbol

MARCH7

UniProt

NP_073737 (Human)

Additional Axotrophin Products

Product Documents for Axotrophin Antibody (4G3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Axotrophin Antibody (4G3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Axotrophin Antibody (4G3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Axotrophin Antibody (4G3) - Azide and BSA Free and earn rewards!

Have you used Axotrophin Antibody (4G3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies