BAF57 Antibody (6G11) - Azide and BSA Free

Novus Biologicals | Catalog # H00006605-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6G11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY

Specificity

SMARCE1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for BAF57 Antibody (6G11) - Azide and BSA Free

Western Blot: BAF57 Antibody (6G11) [H00006605-M01]

Western Blot: BAF57 Antibody (6G11) [H00006605-M01]

Western Blot: BAF57 Antibody (6G11) [H00006605-M01] - Analysis of SMARCE1 transfected lysate using anti-SMARCE1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SMARCE1 MaxPab rabbit polyclonal antibody.

Applications for BAF57 Antibody (6G11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: BAF57

The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.

Alternate Names

BAF57BRG1-associated factor 57, chromatin remodeling complex BRG1-associated factor 57, subfamily e, member 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin e1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily E member 1

Entrez Gene IDs

6605 (Human)

Gene Symbol

SMARCE1

OMIM

603111 (Human)

Additional BAF57 Products

Product Documents for BAF57 Antibody (6G11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BAF57 Antibody (6G11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAF57 Antibody (6G11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review BAF57 Antibody (6G11) - Azide and BSA Free and earn rewards!

Have you used BAF57 Antibody (6G11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...