BLMH/Bleomycin Hydrolase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55141

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BLMH/Bleomycin Hydrolase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to BLMH(bleomycin hydrolase) The peptide sequence was selected from the middle region of BLMH. Peptide sequence EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BLMH/Bleomycin Hydrolase Antibody - BSA Free

Western Blot: BLMH/Bleomycin Hydrolase Antibody [NBP1-55141]

Western Blot: BLMH/Bleomycin Hydrolase Antibody [NBP1-55141]

Western Blot: BLMH/Bleomycin Hydrolase Antibody [NBP1-55141] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for BLMH/Bleomycin Hydrolase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BLMH/Bleomycin Hydrolase

The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

BMH

Gene Symbol

BLMH

UniProt

Q13867

Additional BLMH/Bleomycin Hydrolase Products

Product Documents for BLMH/Bleomycin Hydrolase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BLMH/Bleomycin Hydrolase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BLMH/Bleomycin Hydrolase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BLMH/Bleomycin Hydrolase Antibody - BSA Free and earn rewards!

Have you used BLMH/Bleomycin Hydrolase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies