CACNG7 Antibody (1F7) - Azide and BSA Free

Novus Biologicals | Catalog # H00059284-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1F7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CACNG7 (NP_114102.2, 203 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP

Specificity

CACNG7 - calcium channel, voltage-dependent, gamma subunit 7 (1F7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for CACNG7 Antibody (1F7) - Azide and BSA Free

Sandwich ELISA: CACNG7 Antibody (1F7) [H00059284-M01] - Detection limit for recombinant GST tagged CACNG7 is 0.03 ng/ml as a capture antibody.

Applications for CACNG7 Antibody (1F7) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CACNG7

The mouse protein stargazin is one of five subunits comprising neuronal voltage-gated calcium channels. This subunit, gamma, is thought to stabilize the calcium channel in an inactive (closed) state. Mutations in the gene encoding stargazin have been associated with absence seizures, also known as petit-mal or spike-wave seizures. The protein encoded by this gene is structurally similar to the mouse stargazin protein and is a member of the neuronal calcium channel gamma subunit protein family. However, it appears unlikely that the encoded protein is part of a functional calcium channel. Rather, it appears to inhibit the expression of a specific calcium channel subunit. [provided by RefSeq]

Alternate Names

calcium channel, voltage-dependent, gamma subunit 7, Neuronal voltage-gated calcium channel gamma-7 subunit, voltage-dependent calcium channel gamma-7 subunit

Entrez Gene IDs

59284 (Human)

Gene Symbol

CACNG7

Additional CACNG7 Products

Product Documents for CACNG7 Antibody (1F7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CACNG7 Antibody (1F7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CACNG7 Antibody (1F7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CACNG7 Antibody (1F7) - Azide and BSA Free and earn rewards!

Have you used CACNG7 Antibody (1F7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...