Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free

Novus Biologicals | Catalog # H00023563-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2E6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CHST5 (NP_036258.1, 310 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD

Specificity

CHST5 - carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 (2E6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images

Sandwich ELISA: Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) [H00023563-M05] - Detection limit for recombinant GST tagged CHST5 is 0.1 ng/ml as a capture antibody.

Applications

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 5/CHST5

The carbohydrates of glycoconjugates are highly diverse structures with variation in monosaccharide composition, glycosidic linkage positions, and branching of chains. Further diversity is added by the covalent addition of sulfate moieties to particular hydroxyl groups and amino groups of saccharides. The sulfate modifications of glycoproteins can be extensive in amount and frequently occur at high density. They can have a profound effect on the physiochemical properties of the glycoconjugates, at least in part through the addition of negative charge. Carbohydrate sulfation plays a critical role in many biologic processes. CHST5 belongs to the GST family of sulfotransferases, which also includes CHST1 (MIM 603797), CHST2 (MIM 603798), CHST3 (MIM 603799), and LSST. These enzymes are 6-O-sulfotransferases, which add sulfate to C6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) (Lee et al., 1999 [PubMed 10491328]).[supplied by OMIM]

Alternate Names

CHST5, GlcNAc6ST3, GST4-alpha, hIGn6ST, I-GlcNAc6ST

Entrez Gene IDs

23563 (Human)

Gene Symbol

CHST5

Additional Carbohydrate Sulfotransferase 5/CHST5 Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free

Customer Reviews

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail