Casein Kinase 2 alpha Antibody (2P3M7)
Novus Biologicals | Catalog # NBP3-15858
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 2P3M7 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (P68400). MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Casein Kinase 2 alpha Antibody (2P3M7)
Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] -
Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] - Western blot analysis of various lysates, using Casein Kinase 2 alpha antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] -
Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] - Western blot analysis of extracts from wild type(WT) and Casein Kinase 2 alpha knockdown (KD) 293T cells, using Casein Kinase 2 alpha antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Applications for Casein Kinase 2 alpha Antibody (2P3M7)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Casein Kinase 2 alpha
Alternate Names
CK2A1, CSNK2A1
Gene Symbol
CSNK2A1
Additional Casein Kinase 2 alpha Products
Product Documents for Casein Kinase 2 alpha Antibody (2P3M7)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Casein Kinase 2 alpha Antibody (2P3M7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Casein Kinase 2 alpha Antibody (2P3M7)
There are currently no reviews for this product. Be the first to review Casein Kinase 2 alpha Antibody (2P3M7) and earn rewards!
Have you used Casein Kinase 2 alpha Antibody (2P3M7)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...