Casein Kinase 2 alpha Antibody (2P3M7)

Novus Biologicals | Catalog # NBP3-15858

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2P3M7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (P68400). MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Casein Kinase 2 alpha Antibody (2P3M7)

Casein Kinase 2 alpha Antibody (2P3M7)

Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] -

Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] - Western blot analysis of various lysates, using Casein Kinase 2 alpha antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Casein Kinase 2 alpha Antibody (2P3M7)

Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] -

Western Blot: Casein Kinase 2 alpha Antibody (2P3M7) [NBP3-15858] - Western blot analysis of extracts from wild type(WT) and Casein Kinase 2 alpha knockdown (KD) 293T cells, using Casein Kinase 2 alpha antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Casein Kinase 2 alpha Antibody (2P3M7)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Casein Kinase 2 alpha

Casein kinase I (also designated CKI) and casein kinase II (also designated CKII) compose a family of serine/ threonine protein kinases which are present in all eukaryotes examined to date. CKI family members, which include CKIalpha, gamma, e and delta, have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. CKII is usually expressed as a tetrameric complex consisting of either an alpha2beta2 or an alphaalpha'beta2 structure. The a catalytic subunit is stimulated by the beta regulatory subunit, which undergoes autophosphorylation. CKII activity is high in the cytosol and nucleus of proliferating and differentiating cells. CKII is known to phosphorylate more than 100 different substrates including nuclear oncoproteins, transcription factors and enzymes involved in DNA metabolism.

Alternate Names

CK2A1, CSNK2A1

Gene Symbol

CSNK2A1

Additional Casein Kinase 2 alpha Products

Product Documents for Casein Kinase 2 alpha Antibody (2P3M7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Casein Kinase 2 alpha Antibody (2P3M7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Casein Kinase 2 alpha Antibody (2P3M7)

There are currently no reviews for this product. Be the first to review Casein Kinase 2 alpha Antibody (2P3M7) and earn rewards!

Have you used Casein Kinase 2 alpha Antibody (2P3M7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways
Notch Signaling Pathway Thumbnail