Catenin alpha 1 Antibody (9O1V3)

Novus Biologicals | Catalog # NBP3-15613

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9O1V3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Catenin alpha 1 (P35221). MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Catenin alpha 1 Antibody (9O1V3)

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613]

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613]

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613] - Western blot analysis of extracts of various cell lines, using Catenin alpha 1 antibody (NBP3-15613) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Knockout Validated: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613]

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613]

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613] - Western blot analysis of extracts from normal (control) and Catenin alpha 1 knockout (KO) 293T cells, using Catenin alpha 1 antibody (NBP3-15613) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for Catenin alpha 1 Antibody (9O1V3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Catenin alpha 1

Cadherin and catenin compose cell adhesion complex and are indispensable for tight cell-cell adhesion. Dysfunction of this adhesion complex causes dissociation of cancer cells from primary tumor nodules, thus possibly contributing to cancer invasion and metastasis (1). At least three proteins (alpha, beta, and gamma catenin) comprise the cytoplasmic domain of the cadherin cell-cell adhesion complex. Data, with the reported structure of other catenin genes, suggest that vinculin and alpha-catenin generate a superfamily of proteins mediating membrane-cytoskeletal associations (2). Presenilin-1 (PS1) overexpression in human kidney cells enhances cell-cell adhesion and data show that PS1 incorporates into the cadherin/catenin adhesion system and regulates cell-cell adhesion. PS1 concentrates at intercellular contacts in epithelial tissue; in brain, it forms complexes with both E- and N-cadherin and concentrates at synaptic adhesions (3).

Alternate Names

Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Renal carcinoma antigen NY-REN-13

Gene Symbol

CTNNA1

Additional Catenin alpha 1 Products

Product Documents for Catenin alpha 1 Antibody (9O1V3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Catenin alpha 1 Antibody (9O1V3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Catenin alpha 1 Antibody (9O1V3)

There are currently no reviews for this product. Be the first to review Catenin alpha 1 Antibody (9O1V3) and earn rewards!

Have you used Catenin alpha 1 Antibody (9O1V3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...