CD97 Antibody (3E5L8)

Novus Biologicals | Catalog # NBP3-33340

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3E5L8
View all CD97 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 21-398 of human CD97 (NP_510966.1).

Sequence:
QDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit CD97 Antibody (3E5L8) (NBP3-33340) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD97 Antibody (3E5L8)

CD97 Antibody (3E5L8)

Western Blot: CD97 Antibody (3E5L8) [NBP3-33340] -

Western Blot: CD97 Antibody (3E5L8) [NBP3-33340] - Western blot analysis of lysates from U-937 cells, using CD97 Rabbit mAb at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:200000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.

Applications for CD97 Antibody (3E5L8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CD97

CD97, a CD55 Receptor, is a leukocyte antigen located on most activated leukocytes. CD97 is highly homologous to EMR2 with five EGF-like domains in the N-terminal extracellular domain, suggesting that it may be involved in cell signaling as well as in cell adhesion (Hamann et al., 1996). Two variants are produced by alternative splicing, where the shorter form lacks exons 5 and 6 and reduces the number of EGF-like domains from 5 to 3, compared to the full-length isoform. CD97 is associated with with the activated lesions of multiple sclerosis. CD97 expression is also implicated in the dedifferentiation of colon and thyroid tumors. CD97 is expressed abundantly in cells of hematopoietic origin and is markedly upregulated on activated T and B cells. ESTs have been isolated from a wide variety of tissue libraries.

Alternate Names

CD97

Gene Symbol

ADGRE5

Additional CD97 Products

Product Documents for CD97 Antibody (3E5L8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD97 Antibody (3E5L8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD97 Antibody (3E5L8)

There are currently no reviews for this product. Be the first to review CD97 Antibody (3E5L8) and earn rewards!

Have you used CD97 Antibody (3E5L8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies