Claudin-14 Antibody (3D11) - Azide and BSA Free

Novus Biologicals | Catalog # H00023562-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3D11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR

Specificity

Reacts with claudin 14.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Claudin-14 Antibody (3D11) - Azide and BSA Free

Sandwich ELISA: Claudin-14 Antibody (3D11) [H00023562-M01] - Detection limit for recombinant GST tagged CLDN14 is 0.3 ng/ml as a capture antibody.
Immunoprecipitation: Claudin-14 Antibody (3D11) [H00023562-M01]

Immunoprecipitation: Claudin-14 Antibody (3D11) [H00023562-M01]

Immunoprecipitation: Claudin-14 Antibody (3D11) [H00023562-M01] - Analysis of CLDN14 transfected lysate using anti-CLDN14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN14 MaxPab rabbit polyclonal antibody.

Applications for Claudin-14 Antibody (3D11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Claudin-14

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. The encoded protein also binds specifically to the WW domain of Yes-associated protein. Defects in this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Alternate Names

Claudin14, CLDN14, DFNB29

Entrez Gene IDs

23562 (Human)

Gene Symbol

CLDN14

UniProt

Additional Claudin-14 Products

Product Documents for Claudin-14 Antibody (3D11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-14 Antibody (3D11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Claudin-14 Antibody (3D11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Claudin-14 Antibody (3D11) - Azide and BSA Free and earn rewards!

Have you used Claudin-14 Antibody (3D11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...