Q: I am looking for a recombinant mouse C5 as standard for a mouse C5 ELISA. Is your product # H00000727-Q01 good for this?

A: This product is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. H00000727-Q01 is a partial recombinant protein, so you will want to make sure your antibody will recognize the portion of C5 present in this protein before using it as a control.

Recombinant Human Complement C5 GST (N-Term) Protein

Novus Biologicals | Catalog # H00000727-Q01

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all Complement C5 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-112 of Human C5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Complement C5 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Complement C5 GST (N-Term) Protein [H00000727-Q01]

SDS-Page: Recombinant Human Complement C5 Protein [H00000727-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00000727-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Complement C5

C5 - complement component 5

Alternate Names

anaphylatoxin C5a analog, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, C5, complement C5, complement component 5, CPAMD4MGC142298, FLJ17816, FLJ17822

Gene Symbol

Additional Complement C5 Products

Product Documents for Recombinant Human Complement C5 GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human Complement C5 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Complement C5 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Complement C5 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Complement C5 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image