CTGF/CCN2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-86571PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTGF.

Source: E. coli

Amino Acid Sequence: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86571.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-86571PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CTGF/CCN2

Connective Tissue Growth Factor (CTGF) is a 38kDa, cysteine-rich, secreted peptide. CTGF promotes endothelial cell growth, migration, adhesion and survival. and is thus implicated in endothelial cell function and angiogenesis. CTGF is implicated in are embryogenesis, wound healing and regulation of extracellular matrix production, and is required for normal skeletal growth.

CTGF antibodies are useful tools for angiogenesis and cell structure research, and for studies on certian types of cancer.

Long Name

Connective Tissue Growth Factor

Alternate Names

CCN2, CTGRP, Fisp12, HCS24, IGFBP-8, NOV2

Gene Symbol

CCN2

Additional CTGF/CCN2 Products

Product Documents for CTGF/CCN2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CTGF/CCN2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for CTGF/CCN2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review CTGF/CCN2 Recombinant Protein Antigen and earn rewards!

Have you used CTGF/CCN2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for CTGF/CCN2 Recombinant Protein Antigen

Showing  1 - 1 的 1 FAQ Showing All
  • Q: We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.

    A:

    Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...