DHX38 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38087

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DHX38 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2).

Sequence:
VTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

141 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DHX38 Antibody - BSA Free

DHX38 Antibody

Western Blot: DHX38 Antibody [NBP3-38087] -

Western Blot: DHX38 Antibody [NBP3-38087] - Western blot analysis of various lysates using DHX38 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 20s.

Applications for DHX38 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DHX38

DHX38, also known as Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, is a 140.5 kDa 1,227 amino acid protein that is utilized in multiple cellular processes, including ribosome and spliceosome assembly, as a member of the DEAD box protein family. Researchers are currently studying ties between the protein and North American Indian Childhood cirrhosis. The protein interacts in mRNA processing, mRNA splicing, RNA Polymerase II transcription, and spliceosome pathways with other proteins such as RBM10, SNRNP200, GPKOW, TXNL4A, and DHX16.

Alternate Names

ATP-dependent RNA helicase DHX38, DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38, DEAH (Asp-Glu-Ala-His) box polypeptide 38, DEAH box protein 38, EC 3.6.1, EC 3.6.4.13, KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16, PRP16 homolog of S.cerevisiae, PRP16hPrp16, PRPF16

Gene Symbol

DHX38

Additional DHX38 Products

Product Documents for DHX38 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DHX38 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DHX38 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHX38 Antibody - BSA Free and earn rewards!

Have you used DHX38 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies