DNA Polymerase Kappa Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35208

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA Polymerase Kappa (NP_057302.1).

Sequence:
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNA Polymerase Kappa Antibody - BSA Free

DNA Polymerase Kappa Antibody

Western Blot: DNA Polymerase Kappa Antibody [NBP3-35208] -

Western Blot: DNA Polymerase Kappa Antibody [NBP3-35208] - Western blot analysis of various lysates using DNA Polymerase Kappa Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
DNA Polymerase Kappa Antibody

Western Blot: DNA Polymerase Kappa Antibody [NBP3-35208] -

Western Blot: DNA Polymerase Kappa Antibody [NBP3-35208] - Western Blot analysis of various lysates using DNA Polymerase Kappa Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
DNA Polymerase Kappa Antibody

Western Blot: DNA Polymerase Kappa Antibody [NBP3-35208] -

Western Blot: DNA Polymerase Kappa Antibody [NBP3-35208] - Western Blot analysis of various lysates using DNA Polymerase Kappa Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for DNA Polymerase Kappa Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNA Polymerase Kappa

DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity

Alternate Names

DINB protein, DINPPOLQDINB1EC 2.7.7.7, DNA polymerase kappa, polymerase (DNA directed) kappa

Gene Symbol

POLK

Additional DNA Polymerase Kappa Products

Product Documents for DNA Polymerase Kappa Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Polymerase Kappa Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Polymerase Kappa Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Polymerase Kappa Antibody - BSA Free and earn rewards!

Have you used DNA Polymerase Kappa Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...