EHHADH Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38176

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EHHADH Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 444-723 of human EHHADH (NP_001957.2).

Sequence:
EVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPSSKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EHHADH Antibody - BSA Free

EHHADH Antibody

Western Blot: EHHADH Antibody [NBP3-38176] -

Western Blot: EHHADH Antibody [NBP3-38176] - Western blot analysis of various lysates using EHHADH Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
EHHADH Antibody

Western Blot: EHHADH Antibody [NBP3-38176] -

Western Blot: EHHADH Antibody [NBP3-38176] - Western Blot analysis of various lysates using EHHADH Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for EHHADH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EHHADH

The protein encoded by the EHHADH gene is a bifunctional enzyme and is one of the four enzymes of the peroxisomalbeta-oxidation pathway. The N-terminal region of the encoded protein contains enoyl-CoA hydratase activity while theC-terminal region contains 3-hydroxyacyl-CoA dehydrogenase activity. Defects in this gene are a cause of peroxisomaldisorders such as Zellweger syndrome. Two transcript variants encoding different isoforms have been found for thisgene. (provided by RefSeq)

Alternate Names

enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase, enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase, LBFP, LBP, L-PBE, PBFEMGC120586, peroxisomal, peroxisomal bifunctional enzyme3,2-trans-enoyl-CoA isomerase, peroxisomal enoyl-CoA hydratase

Gene Symbol

EHHADH

Additional EHHADH Products

Product Documents for EHHADH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EHHADH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EHHADH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EHHADH Antibody - BSA Free and earn rewards!

Have you used EHHADH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies