ELAC1 Antibody (1G2) - Azide and BSA Free
Novus Biologicals | Catalog # H00055520-M01
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Western Blot, ELISA, Sandwich ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 1G2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
ELAC1 (NP_061166, 282 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTLAEDFMVISIPIK
Specificity
ELAC1 (1G2)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for ELAC1 Antibody (1G2) - Azide and BSA Free
Western Blot: ELAC1 Antibody (1G2) [H00055520-M01]
Western Blot: ELAC1 Antibody (1G2) [H00055520-M01] - ELAC1 monoclonal antibody (M01), clone 1G2 Analysis of ELAC1 expression in PC-12.
Sandwich ELISA: ELAC1 Antibody (1G2) [H00055520-M01] - Detection limit for recombinant GST tagged ELAC1 is approximately 0.3ng/ml as a capture antibody.
Applications for ELAC1 Antibody (1G2) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ELAC1
Alternate Names
D29elaC (E. coli) homolog 1, Deleted in Ma29, EC 3.1.26.11, elaC homolog 1 (E. coli), ElaC homolog protein 1, FLJ59261, Ribonuclease Z 1, RNase Z 1, tRNA 3 endonuclease 1, tRNA 3' processing endoribonuclease, tRNA Z (short form), tRNase Z 1, tRNase ZS, zinc phosphodiesterase ELAC protein 1
Entrez Gene IDs
55520 (Human)
Gene Symbol
ELAC1
OMIM
608079 (Human)
UniProt
Additional ELAC1 Products
Product Documents for ELAC1 Antibody (1G2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ELAC1 Antibody (1G2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ELAC1 Antibody (1G2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ELAC1 Antibody (1G2) - Azide and BSA Free and earn rewards!
Have you used ELAC1 Antibody (1G2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...