EPHX2 Antibody (8E2X2)

Novus Biologicals | Catalog # NBP3-33234

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8E2X2
View all Epoxide Hydrolase 2/EPHX2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913).

Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit EPHX2 Antibody (8E2X2) (NBP3-33234) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for EPHX2 Antibody (8E2X2)

EPHX2 Antibody (8E2X2)

Western Blot: EPHX2 Antibody (8E2X2) [NBP3-33234] -

Western Blot: EPHX2 Antibody (8E2X2) [NBP3-33234] - Western blot analysis of various lysates using EPHX2 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
EPHX2 Antibody (8E2X2)

Western Blot: EPHX2 Antibody (8E2X2) [NBP3-33234] -

Western Blot: EPHX2 Antibody (8E2X2) [NBP3-33234] - Western blot analysis of lysates from Rat heart, using EPHX2 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for EPHX2 Antibody (8E2X2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Epoxide Hydrolase 2/EPHX2

EPHX2 encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Alternate Names

Bifunctional Epoxide Hydrolase 2, CEH, EPHX2, Epoxide Hydratase 2, Epoxide Hydrolase 2, Cytosolic, SEH

Gene Symbol

EPHX2

Additional Epoxide Hydrolase 2/EPHX2 Products

Product Documents for EPHX2 Antibody (8E2X2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EPHX2 Antibody (8E2X2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Customer Reviews for EPHX2 Antibody (8E2X2)

There are currently no reviews for this product. Be the first to review EPHX2 Antibody (8E2X2) and earn rewards!

Have you used EPHX2 Antibody (8E2X2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies