FBXO11 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-55066
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Human
Applications
Western Blot, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to FBXO11(F-box protein 11) The peptide sequence was selected from the middle region of FBXO11 (NP_079409).
Peptide sequence HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for FBXO11 Antibody - BSA Free
Western Blot: FBXO11 Antibody [NBP1-55066]
Western Blot: FBXO11 Antibody [NBP1-55066] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/mlWestern Blot: FBXO11 Antibody [NBP1-55066]
Western Blot: FBXO11 Antibody [NBP1-55066] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate FBXO11 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cellsApplications for FBXO11 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FBXO11
Alternate Names
F-box only protein 11, F-box protein 11, FBX11MGC44383, FLJ12673, PRMT9VIT1protein arginine N-methyltransferase 9, ubiquitin protein ligase E3 component n-recognin 6, UBR6, VIT-1, Vitiligo-associated protein 1, vitiligo-associated protein VIT-1
Gene Symbol
FBXO11
UniProt
Additional FBXO11 Products
Product Documents for FBXO11 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FBXO11 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for FBXO11 Antibody - BSA Free
Customer Reviews for FBXO11 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FBXO11 Antibody - BSA Free and earn rewards!
Have you used FBXO11 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...