FGF-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98443

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is FGF8 - middle region. Peptide sequence LIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FGF-8 Antibody - BSA Free

Western Blot: FGF-8 Antibody [NBP1-98443]

Western Blot: FGF-8 Antibody [NBP1-98443]

Western Blot: FGF-8 Antibody [NBP1-98443] - Host: Mouse. Target Name: FGF8. Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml
Western Blot: FGF-8 Antibody [NBP1-98443]

Western Blot: FGF-8 Antibody [NBP1-98443]

Western Blot: FGF-8 Antibody [NBP1-98443] - PANC1 Cell Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for FGF-8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGF-8

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.

Long Name

Fibroblast Growth Factor 8

Alternate Names

AIGF, FGF8, HBGF-8

Gene Symbol

FGF8

UniProt

Additional FGF-8 Products

Product Documents for FGF-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FGF-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FGF-8 Antibody - BSA Free and earn rewards!

Have you used FGF-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for FGF-8 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We are working on fgf8 signaling in zebrafish and we would like to use fgf8 antibody for IHC but we are not sure whether it will work on fish because the antibody I found on your website is for mammalian system, not fish. So, I would like to know whether you have some information for usage on fish or you can kindly provide to test on zebrafish?

    A:

    The immunogen for NBP1-98443 shares 80% similarity with zebrafish, and as a polyclonal antibody, it should cross-react. This is currently our only antibody that is predicted to cross-react with zebrafish, although it hasn't been tested for this and is not guaranteed. If you would like to test this antibody in zebrafish for IHC, then I can recommend you our Innovator's Reward program. Our Innovator's Reward program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product. Reviews may also be submitted by emailing innovators@novusbio.com.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies