Fibrillin 1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-84723PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBN1.

Source: E. coli

Amino Acid Sequence: HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84723.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-84723PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Fibrillin-1/FBN1

Long Name

Fibrillin-1

Alternate Names

ACMICD, Asprosin, Fibrillin 1, GPHYSD2, SSKS, WMS2

Gene Symbol

FBN1

Additional Fibrillin-1/FBN1 Products

Product Documents for Fibrillin 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fibrillin 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Fibrillin 1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Fibrillin 1 Recombinant Protein Antigen and earn rewards!

Have you used Fibrillin 1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Fibrillin 1 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: Hi - I have been looking at the fibrillin1 antibodies on your website. You indicate that some may be suitable for canine tissue on your website. could you let me know which of the 10 antibodies is the most suitable for canine.

    A: We have unfortuantely not tested any of our products in canine samples. If you would like to try one of our product with canine samples, you would qualify for our Innovator's Reward Program. In exchange for a review of our product in an untested application or species, we would issue you a credit voucher for the purchase price. If you would like us to check the homology of a certain product against the canine sequence, just contact our technical support department at technical@novusbio.com.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...