FPRL1/FPR2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-90180PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FPR2.

Source: E. coli

Amino Acid Sequence: DTYCTFNFASWGGTPEERLKVAITMLTARG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90180.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-90180PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FPRL1/FPR2

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)

Long Name

Formyl Peptide Receptor-like 1

Alternate Names

ALXR, FMLP-R-I, FPR2, HM63, LXA4 Receptor, RFP

Gene Symbol

FPR2

Additional FPRL1/FPR2 Products

Product Documents for FPRL1/FPR2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FPRL1/FPR2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for FPRL1/FPR2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review FPRL1/FPR2 Recombinant Protein Antigen and earn rewards!

Have you used FPRL1/FPR2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for FPRL1/FPR2 Recombinant Protein Antigen

Showing  1 - 1 的 1 FAQ Showing All
  • Q: I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?

    A: To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...

Associated Pathways

A-beta Pathways: Uptake & Degradation
A-beta Pathways: Uptake & Degradation Thumbnail