GLP-1R Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09432

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse GLP-1R (NP_067307). Peptide sequence YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GLP-1R Antibody - BSA Free

Western Blot: GLP-1R Antibody [NBP3-09432]

Western Blot: GLP-1R Antibody [NBP3-09432]

Western Blot: GLP-1R Antibody [NBP3-09432] - Western blot analysis of GLP-1R in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

Applications for GLP-1R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GLP-1R

GLP1R, a Glucagon Receptor, has been suggested to affect the feelings of satiety or hunger, sensation of glucose levels, control of glucagon sensitivity of islets, and non insulin-dependent diabetes mellitus. Glucagon-like peptide 1 is an incretin hormone produced by enteroendocrine L-cells in the intestinal mucosa. The hormone is released in response to food intake and plays an important role in maintaining blood glucose homeostasis. Stimulation of the GLP-1R by endogenous hormone induces multiple complementary mechanisms, which together result in a lowering of circulating blood glucose levels. These mechanisms include receptor-mediated enhancement of glucose-induced insulin secretion from pancreatic -cells, inhibition of gastric emptying with a delay in the gastrointestinal resorption of nutrients, inhibition of glucagon secretion, and inhibition of food intake. Desensitization of GLP1R on pancreatic beta-cells is one of the causes of non insulin-dependent diabetes mellitus (NIDDM). GLP1R knockout mice are viable, develop normally, but exhibit increased levels of blood glucose following oral glucose challenge in association with diminished levels of circulating insulin. Recently it has been shown that overexpression of glucagon-like peptide-1 receptor improves learning in rats (During et al. 2003). GLP1R has been reported in pancreas, brain, heart, kidney, lung, and stomach. ESTs have been isolated from kidney and skin libraries.

Long Name

Glucagon-like Peptide 1 Receptor

Alternate Names

GLP1R

Gene Symbol

GLP1R

Additional GLP-1R Products

Product Documents for GLP-1R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GLP-1R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GLP-1R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GLP-1R Antibody - BSA Free and earn rewards!

Have you used GLP-1R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...