GNRHR2 Antibody (1A5) - Azide and BSA Free

Novus Biologicals | Catalog # H00114814-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1A5

Format

Azide and BSA Free
View all GNRHR2 Primary Antibodies »

Product Specifications

Immunogen

GNRHR2 (NP_001457, 237 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Reactivity Notes

This product is reactive against Human.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for GNRHR2 Antibody (1A5) - Azide and BSA Free

Sandwich ELISA: GNRHR2 Antibody (1A5) [H00114814-M02] - Detection limit for recombinant GST tagged GNRHR2 is 0.03 ng/ml as a capture antibody.

Applications for GNRHR2 Antibody (1A5) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GNRHR2

The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14.

Alternate Names

AC4, adenylate cyclase 4, adenylate cyclase type 4, Adenylate cyclase type IV, Adenylyl cyclase 4, ATP pyrophosphate-lyase 4, EC 4.6.1, EC 4.6.1.1

Gene Symbol

GNRHR2

Additional GNRHR2 Products

Product Documents for GNRHR2 Antibody (1A5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GNRHR2 Antibody (1A5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNRHR2 Antibody (1A5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GNRHR2 Antibody (1A5) - Azide and BSA Free and earn rewards!

Have you used GNRHR2 Antibody (1A5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies