Recombinant Human HE4/WFDC2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00010406-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection, SDS-PAGE
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 31-124 of Human WFDC2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.08 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human HE4/WFDC2 GST (N-Term) Protein [H00010406-P01]

SDS-PAGE: Recombinant Human HE4/WFDC2 GST (N-Term) Protein [H00010406-P01]

SDS-Page: Recombinant Human HE4/WFDC2 Protein [H00010406-P01]

Formulation, Preparation, and Storage

H00010406-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: HE4/WFDC2

WFDC2( AAH46106, 31 a.a. - 125 a.a.) recombinant protein with GST.

Long Name

WAP Four-disulfide Core Domain protein 2

Alternate Names

EDDM4, WAP5, WFDC2

Gene Symbol

WFDC2

Additional HE4/WFDC2 Products

Product Documents for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

Customer Reviews for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human HE4/WFDC2 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human HE4/WFDC2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

Showing  1 - 2 的 2 FAQs Showing All
  • Q: I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?

    A:

    At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following here

  • Q: We will want to use this full-length protein, but we will also want to use the protein with the GST tag removed. How can we remove the tag from this sequence?

    A:

    This is a product we distribute for a Taiwanese company called Abnova. Here is a link, provided by Abnova, to the protocol for removing the GST tag from the full length protein.

  • Q: I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?

    A:

    At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following here

  • Q: We will want to use this full-length protein, but we will also want to use the protein with the GST tag removed. How can we remove the tag from this sequence?

    A:

    This is a product we distribute for a Taiwanese company called Abnova. Here is a link, provided by Abnova, to the protocol for removing the GST tag from the full length protein.

Showing  1 - 2 的 2 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...