HOXB7 Antibody (5B2) - Azide and BSA Free

Novus Biologicals | Catalog # H00003217-M04

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 5B2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA

Specificity

HOXB7 (5B2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HOXB7 Antibody (5B2) - Azide and BSA Free

Western Blot: HOXB7 Antibody (5B2) [H00003217-M04]

Western Blot: HOXB7 Antibody (5B2) [H00003217-M04]

Western Blot: HOXB7 Antibody (5B2) [H00003217-M04] - Analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M04), clone 5B2. Lane 1: HOXB7 transfected lysatE (24 KDa). Lane 2: Non-transfected lysate.
Western Blot: HOXB7 Antibody (5B2) [H00003217-M04]

Western Blot: HOXB7 Antibody (5B2) [H00003217-M04]

Western Blot: HOXB7 Antibody (5B2) [H00003217-M04] - Western blot analysis of HOXB7 over-expressed 293 cell line, cotransfected with HOXB7 Validated Chimera RNAi or non-transfected control. Blot probed with H00003217-M04. GAPDH (36.1 kDa) used as loading control.
Sandwich ELISA: HOXB7 Antibody (5B2) [H00003217-M04] - Detection limit for recombinant GST tagged HOXB7 is approximately 0.1ng/ml as a capture antibody.

Applications for HOXB7 Antibody (5B2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOXB7

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

Long Name

Homeobox B7

Alternate Names

HHO.C1, Hox-2.3, HOX2C

Entrez Gene IDs

3217 (Human)

Gene Symbol

HOXB7

OMIM

142962 (Human)

Additional HOXB7 Products

Product Documents for HOXB7 Antibody (5B2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB7 Antibody (5B2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB7 Antibody (5B2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXB7 Antibody (5B2) - Azide and BSA Free and earn rewards!

Have you used HOXB7 Antibody (5B2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...