Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free

Novus Biologicals | Catalog # H00006767-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2B2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ST13 (AAH15317, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF

Specificity

ST13 - suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (2B2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free

Sandwich ELISA: Hsp70 interacting protein HIP Antibody (2B2) [H00006767-M02] - Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody.

Applications for Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Hsp70 interacting protein HIP

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq]

Alternate Names

AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein

Entrez Gene IDs

6767 (Human)

Gene Symbol

ST13

Additional Hsp70 interacting protein HIP Products

Product Documents for Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free and earn rewards!

Have you used Hsp70 interacting protein HIP Antibody (2B2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...