LATS2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03913

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-145 of human LATS2 (NP_055387.2). FGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LATS2 Antibody - Azide and BSA Free

Western Blot: LATS2 AntibodyAzide and BSA Free [NBP3-03913]

Western Blot: LATS2 AntibodyAzide and BSA Free [NBP3-03913]

Western Blot: LATS2 Antibody [NBP3-03913] - Analysis of extracts of various cell lines, using LATS2 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.

Applications for LATS2 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LATS2

LATS2 encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.

Alternate Names

EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase

Gene Symbol

LATS2

Additional LATS2 Products

Product Documents for LATS2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LATS2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for LATS2 Antibody - Azide and BSA Free

Customer Reviews for LATS2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review LATS2 Antibody - Azide and BSA Free and earn rewards!

Have you used LATS2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...