LYK5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37972

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 25-210 of human LYK5 (NP_699166.2).

Sequence:
FLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LYK5 Antibody - BSA Free

LYK5 Antibody

Western Blot: LYK5 Antibody [NBP3-37972] -

Western Blot: LYK5 Antibody [NBP3-37972] - Western blot analysis of lysates from Mouse skeletal muscle, using LYK5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for LYK5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LYK5

The protein encoded by the LYK5 gene contains a STE20-like kinase domain, but lacks several residues that are critical forcatalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex withserine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39,also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has beenshown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcriptvariants encoding different isoforms have been found for this gene. Additional transcript variants have been describedbut their full-length nature is not known. (provided by RefSeq)

Alternate Names

LYK5FLJ90524, NY-BR-96, protein kinase LYK5, Serologically defined breast cancer antigen NY-BR-96, STE20-like pseudokinase, STE20-related adapter protein, STE20-related adaptor protein, STE20-related kinase adapter protein alpha, STE20-related kinase adaptor alpha, Stlk, STRAD alpha, STRADPMSE

Gene Symbol

STRADA

Additional LYK5 Products

Product Documents for LYK5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LYK5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LYK5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LYK5 Antibody - BSA Free and earn rewards!

Have you used LYK5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...