MBD6 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15957

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 880-980 of human MBD6 (NP_443129.3). PGSRREPGRLALKWGTRGGFNGQMERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MBD6 Antibody - Azide and BSA Free

Western Blot: MBD6 AntibodyAzide and BSA Free [NBP3-15957]

Western Blot: MBD6 AntibodyAzide and BSA Free [NBP3-15957]

Western Blot: MBD6 Antibody [NBP3-15957] - Western blot analysis of extracts of various cell lines, using MBD6 antibody (NBP3-15957) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for MBD6 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MBD6

The MBD6 gene encodes a 1,003 amino acid long, 101 kDA methyl-CpG-binding domain protein 6 that binds to heterochromatin. This gene does not interact with methylated or unmethylated DNA but will interact with genes DUSP1, DUSP12, and ELAVL1. The MBD6 gene has been linked to Rett syndrome.

Alternate Names

methyl-CpG binding domain protein 6, methyl-CpG-binding domain protein 6, methyl-CpG-binding protein MBD6

Gene Symbol

MBD6

Additional MBD6 Products

Product Documents for MBD6 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MBD6 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MBD6 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MBD6 Antibody - Azide and BSA Free and earn rewards!

Have you used MBD6 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...