Recombinant Human MRS2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00057380-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-117 of Human MRS2L

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

38.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human MRS2 GST (N-Term) Protein

Recombinant Human MRS2 Protein [H00057380-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00057380-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: MRS2

MRS2L( AAH01028, 1 a.a. - 118 a.a.) recombinant protein with GST.

Alternate Names

HPT, MGC78523, mitochondrial, MRS2 magnesium homeostasis factor homolog (S. cerevisiae), MRS2-like protein, MRS2-like, magnesium homeostasis factor, MRS2-like, magnesium homeostasis factor (S. cerevisiae)

Gene Symbol

MRS2

Additional MRS2 Products

Product Documents for Recombinant Human MRS2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human MRS2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human MRS2 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human MRS2 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human MRS2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human MRS2 GST (N-Term) Protein

Showing  1 - 11 FAQ Showing All
  • Q: I would like to know, please, if you sell an Mrs2 (Magnesium Transporter) antibody to detect yeast Mrs2. i have seen you have a a couple of them for detection of human Mrs2. As the sequence identity between both species (yeast and human) is low, I am not sure if these antibodies would cross react.

    A:

    Currently we have two antibodies to MRS2. Unfortunately, neither has been tested for cross reaction with the yeast protein. I was also not able to find the yeast sequence to run alignments against our products. If you have this and would like me to run an alignment against our two products, I would be happy to do so. We typically like to see 80+% homology between sequences for ideal cross reaction, but we have seen much lower percentages yield positive results. Since this species would not be covered under our 100% guarantee, we can offer you our Innovators Reward Program if you decide to try one of our products. In exchange for a review of your experiment using one of our products, we would issue you a credit for the purchase price of the antibody for use in a future purchase.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...