MYO19 Antibody (8S3V5)

Novus Biologicals | Catalog # NBP3-33243

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat, Monkey

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8S3V5
View all MYO19 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 450-650 of human MYO19 (Q96H55).

Sequence:
QQEEYAVEGLEWSFINYQDNQPCLDLIEGSPISICSLINEECRLNRPSSAAQLQTRIETALAGSPCLGHNKLSREPSFIVVHYAGPVRYHTAGLVEKNKDPIPPELTRLLQQSQDPLLMGLFPTNPKEKTQEEPPGQSRAPVLTVVSKFKASLEQLLQVLHSTTPHYIRCIKPNSQGQAQTFLQEEVLSQLEACGLVETIH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MYO19 Antibody (8S3V5)

MYO19 Antibody (8S3V5)

Western Blot: MYO19 Antibody (8S3V5) [NBP3-33243] -

Western Blot: MYO19 Antibody (8S3V5) [NBP3-33243] - Western blot analysis of various lysates using MYO19 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
MYO19 Antibody (8S3V5)

Western Blot: MYO19 Antibody (8S3V5) [NBP3-33243] -

Western Blot: MYO19 Antibody (8S3V5) [NBP3-33243] - Western blot analysis of lysates from Rat testis, using MYO19 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for MYO19 Antibody (8S3V5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MYO19

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellularmovements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relativeto actin filaments

Alternate Names

FLJ22865, MYOHD1, myosin head domain containing 1, Myosin head domain-containing protein 1, myosin XIX, myosin-XIX

Gene Symbol

MYO19

Additional MYO19 Products

Product Documents for MYO19 Antibody (8S3V5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MYO19 Antibody (8S3V5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYO19 Antibody (8S3V5)

There are currently no reviews for this product. Be the first to review MYO19 Antibody (8S3V5) and earn rewards!

Have you used MYO19 Antibody (8S3V5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies