Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00008202-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 251-360 of Human NCOA3/AIB1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00008202-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NCOA3

NCOA3/SRC3 (nuclear receptor coactivator 3/steroid receptor coactivator 3 (SRC3)) is a 155 kD member of the p160/steroid receptor coactivator family containing a nuclear localization sequence, bHLH, and PAS domain. There are two reported isoforms of this protein. NCOA3/SRC3 is localized mainly in the cytoplasm, with weak nuclear expression. The protein is translocated to the nucleus upon phosphorylation. NCOA3/SRC3 is widely expressed with high expression in the heart, skeletal muscle, pancreas, and placenta and low expression in the brain. NCOA3/SRC3 is expressed at very low levels in the lung, liver, and kidney and overexpressed in breast and ovarian cancers. This protein has histone acetyltransferase activity and functions as a transcriptional coactivator for steroid and nuclear hormone receptors. Phosphorylation by I kappaB kinase enhances coactivator function. Acetylation by CREB-BP disrupts interaction with nuclear receptors. NCOA3/SRC3 forms a multisubunit coactivation complex with NCOA2 IKKA, IKKB, IKBKG and histone acetyltransferase protein CREB binding protein and has also been shown to interact with PCAF.

Long Name

Nuclear Receptor Co-activator 3

Alternate Names

ACTR, AIB1, KAT13B, pCIP, RAC3, SRC-1, SRC-3, TRAM1

Gene Symbol

NCOA3

Additional NCOA3 Products

Product Documents for Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human NCOA3/AIB1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human NCOA3/AIB1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...