Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-35674
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Sequence:
HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRL
Clonality
Host
Isotype
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] -
Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] - Western blot analysis of lysates from mouse kidney, using Nicotinic Acetylcholine R alpha 4/CHRNA4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] -
Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] - Immunofluorescence analysis of L-929 cells using Nicotinic Acetylcholine R alpha 4/CHRNA4 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: Nicotinic Acetylcholine R alpha 4/CHRNA4
Long Name
Alternate Names
Gene Symbol
Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products
Product Documents for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free and earn rewards!
Have you used Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free
-
Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
A:
A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.