Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35746

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 23-240 of human Nicotinic Acetylcholine R alpha 5/CHRNA5 (NP_000736.2).

Sequence:
RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP3-35746] -

Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP3-35746] - Western blot analysis of various lysates using Nicotinic Acetylcholine R alpha 5/CHRNA5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Applications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 5/CHRNA5

Long Name

Nicotinic Acetylcholine Receptor alpha 5

Alternate Names

CHRNA5, NACHRA5, Nicotinic Acetylcholine Ra5

Gene Symbol

CHRNA5

Additional Nicotinic Acetylcholine R alpha 5/CHRNA5 Products

Product Documents for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...