PARP Antibody (4M9X4) - Cleaved

Novus Biologicals | Catalog # NBP3-15813

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4M9X4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-214 of human PARP (P09874). QLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PARP Antibody (4M9X4) - Cleaved

Western Blot: PARP Antibody (4M9X4)Cleaved [NBP3-15813]

Western Blot: PARP Antibody (4M9X4)Cleaved [NBP3-15813]

Western Blot: PARP Antibody (4M9X4) - Cleaved [NBP3-15813] - Western blot analysis of extracts of various cell lines, using PARP antibody (NBP3-15813) at 1:1000 dilution.Jurkat cells were treated by Staurosporine(1uM) at room temperature for 3 hours. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
PARP Antibody (4M9X4) - Cleaved

Immunoprecipitation: PARP Antibody (4M9X4) - Cleaved [PARP] -

Immunoprecipitation: PARP Antibody (4M9X4) - Cleaved [PARP] - Immunoprecipitation analysis of 600 ug extracts of Jurkat cells using 3 ug PARP antibody. Western blot was performed from the immunoprecipitate using PARP antibody at a dilution of 1:500.

Applications for PARP Antibody (4M9X4) - Cleaved

Application
Recommended Usage

Immunoprecipitation

1:100 - 1:500

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PARP

Poly (ADP-ribose) polymerase (PARP) is protein family primarily invloved in DNA repair and programmed cell death. PARP proteins are activated in response to DNA single strand breaks (SSBs). Upon SSB detection, PARP binds the DNA and synthesizes a PAR chain at the damaged site, which then signals the initiation of DNA repair by other enzymes such as XRCC1, DNA ligase III and DNA polymerase beta. After repair, the PAR chains are degraded via PAR glycohydrolase.

PARP is inactivated by caspase cleavage, leading to a programmed cell death pathway.

Long Name

Poly [ADP-ribose] Polymerase

Alternate Names

ADPRT, PARP1, PPOL

Gene Symbol

PARP1

Additional PARP Products

Product Documents for PARP Antibody (4M9X4) - Cleaved

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARP Antibody (4M9X4) - Cleaved

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PARP Antibody (4M9X4) - Cleaved

There are currently no reviews for this product. Be the first to review PARP Antibody (4M9X4) - Cleaved and earn rewards!

Have you used PARP Antibody (4M9X4) - Cleaved?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for PARP Antibody (4M9X4) - Cleaved

Showing  1 - 22 FAQs Showing All
  • Q: Do you have any 100 coda or bigger controls?

    A:

    I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

  • Q: Do you have any 100 coda or bigger controls?

    A:

    I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...