Patched 2/PTCH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59457

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Patched 2/PTCH2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PTCH2(patched homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of PTCH2. Peptide sequence LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Patched 2/PTCH2 Antibody - BSA Free

Western Blot: Patched 2/PTCH2 Antibody [NBP1-59457]

Western Blot: Patched 2/PTCH2 Antibody [NBP1-59457]

Western Blot: Patched 2 Antibody [NBP1-59457] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for Patched 2/PTCH2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Patched 2/PTCH2

PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. This gene encodes a member of the patched gene family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. This gene is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. Alternative transcript variants have been described, but their biological function has not been determined. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 AF119569.1 1-10 11-534 AY359016.1 3-526 535-2066 AF087651.1 523-2054 2067-2509 AF119569.1 2067-2509 2510-2520 AF087651.1 2498-2508 2521-2700 AF119569.1 2521-2700 2701-3620 AY358555.1 2689-3608 3621-3624 AF087651.1 3609-3612

Alternate Names

ptc2, PTCH2

Gene Symbol

PTCH2

UniProt

Q9Y6C5

Additional Patched 2/PTCH2 Products

Product Documents for Patched 2/PTCH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Patched 2/PTCH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Patched 2/PTCH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Patched 2/PTCH2 Antibody - BSA Free and earn rewards!

Have you used Patched 2/PTCH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies