Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 6H7A4
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human PATZ (NP_055138.2).
Sequence:
PFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR
Sequence:
PFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for PATZ Antibody (6H7A4)
Western Blot: PATZ Antibody (6H7A4) [NBP3-33488] -
Western Blot: PATZ Antibody (6H7A4) [NBP3-33488] - Western Blot analysis of lysates from 293T cells using PATZ Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Applications for PATZ Antibody (6H7A4)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: PATZ
Alternate Names
dJ400N23, MAZRPOZ-, AT hook-, and zinc finger-containing protein 1, PATZZinc finger and BTB domain-containing protein 19, POZ (BTB) and AT hook containing zinc finger 1, Protein kinase A RI subunit alpha-associated protein, RIAZBTB/POZ domain zinc finger transcription factor, ZBTB19BTB-POZ domain zinc finger transcription factor, Zinc finger protein 278Zinc finger sarcoma gene protein, ZNF278POZ-AT hook-zinc finger protein, ZSGMAZ-related factor
Gene Symbol
PATZ1
Additional PATZ Products
Product Documents for PATZ Antibody (6H7A4)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PATZ Antibody (6H7A4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PATZ Antibody (6H7A4)
There are currently no reviews for this product. Be the first to review PATZ Antibody (6H7A4) and earn rewards!
Have you used PATZ Antibody (6H7A4)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...