Peflin Antibody (1X2R7)

Novus Biologicals | Catalog # NBP3-33231

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1X2R7
View all Peflin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Peflin (Q9UBV8).

Sequence:
APGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Peflin Antibody (1X2R7)

Peflin Antibody (1X2R7)

Western Blot: Peflin Antibody (1X2R7) [NBP3-33231] -

Western Blot: Peflin Antibody (1X2R7) [NBP3-33231] - Western blot analysis of various lysates using Peflin Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Peflin Antibody (1X2R7)

Western Blot: Peflin Antibody (1X2R7) [NBP3-33231] -

Western Blot: Peflin Antibody (1X2R7) [NBP3-33231] - Western blot analysis of lysates from Mouse liver, using Peflin Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.

Applications for Peflin Antibody (1X2R7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Peflin

PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpainsmall subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2 (PDCD6; MIM601057) (Kitaura et al., 2001 (PubMed 11278427)).(supplied by OMIM)

Alternate Names

ABP32, PEF protein with a long N-terminal hydrophobic domain, PEF1A, peflin, penta-EF hand domain containing 1, Penta-EF hand domain-containing protein 1, penta-EF-hand domain containing 1

Gene Symbol

PEF1

Additional Peflin Products

Product Documents for Peflin Antibody (1X2R7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Peflin Antibody (1X2R7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Peflin Antibody (1X2R7)

There are currently no reviews for this product. Be the first to review Peflin Antibody (1X2R7) and earn rewards!

Have you used Peflin Antibody (1X2R7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies