Pinin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35709

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pinin (NP_002678.2).

Sequence:
MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Pinin Antibody - BSA Free

Pinin Antibody

Western Blot: Pinin Antibody [NBP3-35709] -

Western Blot: Pinin Antibody [NBP3-35709] - Western blot analysis of various lysates using Pinin Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
Pinin Antibody

Western Blot: Pinin Antibody [NBP3-35709] -

Western Blot: Pinin Antibody [NBP3-35709] - Western Blot analysis of various lysates using Pinin Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Applications for Pinin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pinin

PNN is a nuclear and cell adhesion-related protein involved in cell adhesion, mRNA processing, and transcriptional regulation. PNN functions as a transcriptional regulator by relieving CtBP1-mediated repression of the E-cadherin gene. In the role of mRNA processing, PNN functions as a splicing regulator. The role of PNN in transcription and mRNA processing suggests the role of PNN as a coupling factor for the two processes.

Alternate Names

140 kDa nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, DRS protein, DRSP, DRSSR-like protein, Melanoma metastasis clone A protein, memA, neutrophil protein, Nuclear protein SDK3, pinin, pinin, desmosome associated protein, SDK3

Gene Symbol

PNN

Additional Pinin Products

Product Documents for Pinin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pinin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pinin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pinin Antibody - BSA Free and earn rewards!

Have you used Pinin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...