PSMB10/MECL1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-58937
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to PSMB10(proteasome (prosome, macropain) subunit, beta type, 10) The peptide sequence was selected from the middle region of PSMB10. Peptide sequence DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: beta type-10.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for PSMB10/MECL1 Antibody - BSA Free
Western Blot: PSMB10/MECL1 Antibody [NBP1-58937]
Western Blot: PSMB10 Antibody [NBP1-58937] - Human Placenta lysate, concentration 0.2-1 ug/ml.Western Blot: PSMB10/MECL1 Antibody - BSA Free [NBP1-58937] -
Effects of M3258 and IFN gamma on the expression of IP and constitutive proteasome subunits in TNBC/IBC cells. (A) Western blot analysis of the basal expression levels of LMP7 in TNBC/IBC cell lines. Cells were cultured for 48 h at 37 C before proteins were extracted and analyzed. (B) Western blot analysis of the effects of M3258 on the expression of IP and constitutive proteasome subunits in TNBC/IBC cells. After overnight incubation in the presence or absence of recombinant human IFN gamma (100 IU/mL), the cells were treated with M3258 at the indicated concentrations for 48 h at 37 C. Proteins were then extracted and analyzed. beta -actin levels in the protein extracts were assessed to control for equivalent protein loading in each gel lane. Original western blots are presented in File S1. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40507366), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PSMB10/MECL1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PSMB10/MECL1
Long Name
Proteasome (Prosome, Macropain) Subunit, beta Type, 10
Alternate Names
LMP10, MECl-1, MECL1, Proteasome subunit beta-2i
Gene Symbol
PSMB10
UniProt
Additional PSMB10/MECL1 Products
Product Documents for PSMB10/MECL1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PSMB10/MECL1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for PSMB10/MECL1 Antibody - BSA Free
Customer Reviews for PSMB10/MECL1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PSMB10/MECL1 Antibody - BSA Free and earn rewards!
Have you used PSMB10/MECL1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...