RAB27B Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-79631
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen for this antibody is Rab27b. Peptide sequence YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for RAB27B Antibody - BSA Free
Western Blot: RAB27B Antibody [NBP1-79631]
Western Blot: RAB27B Antibody [NBP1-79631] - Rab27b Antibody Titration: 0.5 ug/ml Positive Control: human testis, mouse liver, brain and testisWestern Blot: RAB27B Antibody [NBP1-79631]
Western Blot: RAB27B Antibody [NBP1-79631] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%Western Blot: RAB27B Antibody [NBP1-79631] -
Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs are critical to the development of muscle wasting in mice. a Elevation of serum Hsp70/90 in LLC tumor-bearing mice is dependent on EV release. LLC cells transduced with lentivirus encoding Rab27a- & Rab27b-specific shRNA or empty vector were analyzed for knockdown effect by western blotting (top). Mice were then implanted with Rab27-deficient or control LLC cells. In 21 days serum levels of EVs, Hsp70/90 were analyzed. b Rab27-deficient LLC tumor does not induce muscle catabolism in mice. Mice derived from a were analyzed for activity of the catabolic markers in TA. c Rab27-deficient LLC tumor does not induce muscle wasting in mice. Mice derived from a were analyzed for muscle wasting. Scale bar, 100 μm. Data (n = 6) were analyzed by analysis of variance or χ2 analysis (for CSA). * denotes a difference (P < 0.05) Image collected & cropped by CiteAb from the following publication (https://www.nature.com/articles/s41467-017-00726-x), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RAB27B Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RAB27B
Alternate Names
C25KG, RAB27B, member RAS oncogene family, ras-related protein Rab-27B
Gene Symbol
RAB27B
UniProt
Additional RAB27B Products
Product Documents for RAB27B Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RAB27B Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RAB27B Antibody - BSA Free
Customer Reviews for RAB27B Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RAB27B Antibody - BSA Free and earn rewards!
Have you used RAB27B Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...